Lineage for d1di0c_ (1di0 C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67948Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 67949Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 67950Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 67951Protein Lumazine synthase [52123] (5 species)
  7. 67989Species Brucella abortus [TaxId:235] [52125] (1 PDB entry)
  8. 67992Domain d1di0c_: 1di0 C: [30959]

Details for d1di0c_

PDB Entry: 1di0 (more details), 2.7 Å

PDB Description: crystal structure of lumazine synthase from brucella abortus

SCOP Domain Sequences for d1di0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1di0c_ c.16.1.1 (C:) Lumazine synthase {Brucella abortus}
sfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartgr
yaaivgaafvidggiydhdfvatavingmmqvqletevpvlsvvltphhfheskehhdff
hahfkvkgveaahaalqivsersria

SCOP Domain Coordinates for d1di0c_:

Click to download the PDB-style file with coordinates for d1di0c_.
(The format of our PDB-style files is described here.)

Timeline for d1di0c_: