Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.16: beta-subunit of the lumazine synthase/riboflavin synthase complex [52120] (1 superfamily) |
Superfamily c.16.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52121] (1 family) |
Family c.16.1.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52122] (1 protein) |
Protein beta-subunit of the lumazine synthase/riboflavin synthase complex [52123] (4 species) |
Species Brucella abortus [TaxId:235] [52125] (1 PDB entry) |
Domain d1di0c_: 1di0 C: [30959] |
PDB Entry: 1di0 (more details), 2.7 Å
SCOP Domain Sequences for d1di0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1di0c_ c.16.1.1 (C:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Brucella abortus} sfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartgr yaaivgaafvidggiydhdfvatavingmmqvqletevpvlsvvltphhfheskehhdff hahfkvkgveaahaalqivsersria
Timeline for d1di0c_:
View in 3D Domains from other chains: (mouse over for more information) d1di0a_, d1di0b_, d1di0d_, d1di0e_ |