Lineage for d1di0c_ (1di0 C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21611Fold c.16: beta-subunit of the lumazine synthase/riboflavin synthase complex [52120] (1 superfamily)
  4. 21612Superfamily c.16.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52121] (1 family) (S)
  5. 21613Family c.16.1.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52122] (1 protein)
  6. 21614Protein beta-subunit of the lumazine synthase/riboflavin synthase complex [52123] (4 species)
  7. 21646Species Brucella abortus [TaxId:235] [52125] (1 PDB entry)
  8. 21649Domain d1di0c_: 1di0 C: [30959]

Details for d1di0c_

PDB Entry: 1di0 (more details), 2.7 Å

PDB Description: crystal structure of lumazine synthase from brucella abortus

SCOP Domain Sequences for d1di0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1di0c_ c.16.1.1 (C:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Brucella abortus}
sfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartgr
yaaivgaafvidggiydhdfvatavingmmqvqletevpvlsvvltphhfheskehhdff
hahfkvkgveaahaalqivsersria

SCOP Domain Coordinates for d1di0c_:

Click to download the PDB-style file with coordinates for d1di0c_.
(The format of our PDB-style files is described here.)

Timeline for d1di0c_: