Lineage for d4rv0a2 (4rv0 A:104-182)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942267Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942268Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2942332Family d.31.1.0: automated matches [254296] (1 protein)
    not a true family
  6. 2942333Protein automated matches [254681] (3 species)
    not a true protein
  7. 2942334Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311439] (1 PDB entry)
  8. 2942335Domain d4rv0a2: 4rv0 A:104-182 [309567]
    Other proteins in same PDB: d4rv0a1, d4rv0a3, d4rv0c1, d4rv0c3, d4rv0e1, d4rv0e3, d4rv0g1, d4rv0g3
    automated match to d4kdib2
    complexed with so4

Details for d4rv0a2

PDB Entry: 4rv0 (more details), 2 Å

PDB Description: crystal structure of tn complex
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase TER94

SCOPe Domain Sequences for d4rv0a2:

Sequence, based on SEQRES records: (download)

>d4rv0a2 d.31.1.0 (A:104-182) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dvkygkrvrilpidestegvtgnlfeiylkpyfleayrpihmgdnfivraamrpiefkvv
ltdpepycivapetvifcd

Sequence, based on observed residues (ATOM records): (download)

>d4rv0a2 d.31.1.0 (A:104-182) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dvkygkrvrilpidnlfeiylkpyfleayrpihmgdnfivraamrpiefkvvltdpepyc
ivapetvifcd

SCOPe Domain Coordinates for d4rv0a2:

Click to download the PDB-style file with coordinates for d4rv0a2.
(The format of our PDB-style files is described here.)

Timeline for d4rv0a2: