Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) |
Family d.31.1.0: automated matches [254296] (1 protein) not a true family |
Protein automated matches [254681] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311439] (1 PDB entry) |
Domain d4rv0g2: 4rv0 G:104-186 [309576] Other proteins in same PDB: d4rv0a1, d4rv0a3, d4rv0c1, d4rv0c3, d4rv0e1, d4rv0e3, d4rv0g1, d4rv0g3 automated match to d4kdib2 complexed with so4 |
PDB Entry: 4rv0 (more details), 2 Å
SCOPe Domain Sequences for d4rv0g2:
Sequence, based on SEQRES records: (download)
>d4rv0g2 d.31.1.0 (G:104-186) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dvkygkrvrilpidestegvtgnlfeiylkpyfleayrpihmgdnfivraamrpiefkvv ltdpepycivapetvifcdgdpi
>d4rv0g2 d.31.1.0 (G:104-186) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dvkygkrvrilpidtgnlfeiylkpyfleayrpihmgdnfivraamrpiefkvvltdpep ycivapetvifcdgdpi
Timeline for d4rv0g2: