Lineage for d4rsuj1 (4rsu J:39-97)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639374Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2639476Protein automated matches [227085] (1 species)
    not a true protein
  7. 2639477Species Human (Homo sapiens) [TaxId:9606] [226417] (4 PDB entries)
  8. 2639488Domain d4rsuj1: 4rsu J:39-97 [309555]
    Other proteins in same PDB: d4rsua_, d4rsub_, d4rsuc_, d4rsud3, d4rsue3, d4rsuf3, d4rsug_, d4rsuh_, d4rsui_, d4rsuj3, d4rsuk3
    automated match to d1jmab1
    complexed with cl, gol, nag

Details for d4rsuj1

PDB Entry: 4rsu (more details), 2.3 Å

PDB Description: crystal structure of the light and hvem complex
PDB Compounds: (J:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d4rsuj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rsuj1 g.24.1.1 (J:39-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

SCOPe Domain Coordinates for d4rsuj1:

Click to download the PDB-style file with coordinates for d4rsuj1.
(The format of our PDB-style files is described here.)

Timeline for d4rsuj1: