Lineage for d4r7la1 (4r7l A:3-208)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2429865Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2429866Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2429867Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2429883Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2429884Species Human (Homo sapiens) [TaxId:9606] [63740] (57 PDB entries)
    Uniprot P09960
  8. 2429915Domain d4r7la1: 4r7l A:3-208 [309415]
    Other proteins in same PDB: d4r7la2, d4r7la3
    automated match to d3b7sa2
    complexed with act, gol, imd, shh, yb, zn

Details for d4r7la1

PDB Entry: 4r7l (more details), 1.66 Å

PDB Description: structure of human leukotriene a4 hydrolase in complex with inhibitor h1
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d4r7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r7la1 b.98.1.1 (A:3-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
dpsrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d4r7la1:

Click to download the PDB-style file with coordinates for d4r7la1.
(The format of our PDB-style files is described here.)

Timeline for d4r7la1: