Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein beta-Lactamase, class A [56606] (16 species) |
Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (27 PDB entries) inhibited by tazobactam Uniprot Q5PSW7 ! Uniprot P14557 22-286 |
Domain d4r3ba_: 4r3b A: [309354] automated match to d1onga_ complexed with 3ge, ma4 |
PDB Entry: 4r3b (more details), 1.37 Å
SCOPe Domain Sequences for d4r3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r3ba_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]} spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd tpasmaernqqiagigaaliehwqr
Timeline for d4r3ba_: