SCOPe 2.07: Domain d4qxfc_: 4qxf C:

Lineage for d4qxfc_ (4qxf C:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
   Pfam PF00757; Pfam PF14843; Pfam PF15913

6. Protein automated matches [190609] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187631] (7 PDB entries)

8. Domain d4qxfc_: 4qxf C: [309025]
   automated match to d4bspa_

Details for d4qxfc_

PDB Entry: 4qxf, 2.25 Å

PDB Description: crystal structure of human lgr4 and rspo1

PDB Compounds: (C:) r-spondin-1

SCOPe Domain Sequences for d4qxfc_:

Sequence; same for both SEQRES and ATOM records:

>d4qxfc_ g.3.9.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikckiehceacfshnfc
tkckeglylhkgrcypacp

Timeline for d4qxfc_:

• d4qxfc_ first appeared in SCOPe 2.06
  
• d4qxfc_ appears in the current release, SCOPe 2.08