Lineage for d1tyfe_ (1tyf E:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480393Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 480394Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 480395Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)
  6. 480396Protein Clp protease, ClpP subunit [52098] (1 species)
  7. 480397Species Escherichia coli [TaxId:562] [52099] (1 PDB entry)
  8. 480402Domain d1tyfe_: 1tyf E: [30889]

Details for d1tyfe_

PDB Entry: 1tyf (more details), 2.2 Å

PDB Description: the structure of clpp at 2.3 angstrom resolution suggests a model for atp-dependent proteolysis

SCOP Domain Sequences for d1tyfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyfe_ c.14.1.1 (E:) Clp protease, ClpP subunit {Escherichia coli}
srgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
hrn

SCOP Domain Coordinates for d1tyfe_:

Click to download the PDB-style file with coordinates for d1tyfe_.
(The format of our PDB-style files is described here.)

Timeline for d1tyfe_: