![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
![]() | Protein Clp protease, ClpP subunit [52098] (11 species) |
![]() | Species Escherichia coli [TaxId:562] [52099] (2 PDB entries) |
![]() | Domain d1tyfe_: 1tyf E: [30889] |
PDB Entry: 1tyf (more details), 2.3 Å
SCOPe Domain Sequences for d1tyfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tyfe_ c.14.1.1 (E:) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} srgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt hrn
Timeline for d1tyfe_: