Lineage for d1tyfb_ (1tyf B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460579Protein Clp protease, ClpP subunit [52098] (10 species)
  7. 2460595Species Escherichia coli [TaxId:562] [52099] (1 PDB entry)
  8. 2460597Domain d1tyfb_: 1tyf B: [30886]

Details for d1tyfb_

PDB Entry: 1tyf (more details), 2.3 Å

PDB Description: the structure of clpp at 2.3 angstrom resolution suggests a model for atp-dependent proteolysis
PDB Compounds: (B:) clp peptidase

SCOPe Domain Sequences for d1tyfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyfb_ c.14.1.1 (B:) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]}
srgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi
tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg
qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt
hrn

SCOPe Domain Coordinates for d1tyfb_:

Click to download the PDB-style file with coordinates for d1tyfb_.
(The format of our PDB-style files is described here.)

Timeline for d1tyfb_: