Lineage for d4qwic_ (4qwi C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230636Domain d4qwic_: 4qwi C: [308835]
    Other proteins in same PDB: d4qwia_, d4qwib_, d4qwie_, d4qwif_, d4qwig_, d4qwih_, d4qwii_, d4qwij_, d4qwik_, d4qwil_, d4qwim_, d4qwin_, d4qwio_, d4qwip_, d4qwis_, d4qwit_, d4qwiu_, d4qwiv_, d4qwiw_, d4qwix_, d4qwiy_, d4qwiz_
    automated match to d4eu2a_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qwic_

PDB Entry: 4qwi (more details), 2.6 Å

PDB Description: yCP beta5-A49S-mutant in complex with carfilzomib
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qwic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwic_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qwic_:

Click to download the PDB-style file with coordinates for d4qwic_.
(The format of our PDB-style files is described here.)

Timeline for d4qwic_: