Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d4qwic_: 4qwi C: [308835] Other proteins in same PDB: d4qwia_, d4qwib_, d4qwie_, d4qwif_, d4qwig_, d4qwih_, d4qwii_, d4qwij_, d4qwik_, d4qwil_, d4qwim_, d4qwin_, d4qwio_, d4qwip_, d4qwis_, d4qwit_, d4qwiu_, d4qwiv_, d4qwiw_, d4qwix_, d4qwiy_, d4qwiz_ automated match to d4eu2a_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qwi (more details), 2.6 Å
SCOPe Domain Sequences for d4qwic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwic_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qwic_: