SCOP 1.69: Domain d1auz__: 1auz -

Lineage for d1auz__ (1auz -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: Anti-sigma factor antagonist SpoIIaa [52091] (1 family)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [52094] (2 PDB entries)

8. Domain d1auz__: 1auz - [30883]

Details for d1auz__

PDB Entry: 1auz

PDB Description: solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis, nmr, 24 structures

SCOP Domain Sequences for d1auz__:

Sequence; same for both SEQRES and ATOM records:

>d1auz__ c.13.2.1 (-) Anti-sigma factor antagonist SpoIIaa {Bacillus subtilis}
slgidmnvkesvlcirltgeldhhtaetlkqkvtqslekddirhivlnledlsfmdssgl
gvilgrykqikqiggemvvcaispavkrlfdmsglfkiirfeqseqqalltlgvas

Timeline for d1auz__:

• d1auz__ first appeared (with stable ids) in SCOP 1.55
  
• d1auz__ appears in SCOP 1.67
  
• d1auz__ appears in SCOP 1.71
  
• d1auz__ appears in the current release, SCOPe 2.08, called d1auza_