SCOPe 2.08: Domain d1auza_: 1auz A:

Lineage for d1auza_ (1auz A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (3 families)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
   automatically mapped to Pfam PF01740

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [52094] (2 PDB entries)

8. Domain d1auza_: 1auz A: [30883]

Details for d1auza_

PDB Entry: 1auz

PDB Description: solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis, nmr, 24 structures

PDB Compounds: (A:) spoiiaa

SCOPe Domain Sequences for d1auza_:

Sequence; same for both SEQRES and ATOM records:

>d1auza_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Bacillus subtilis [TaxId: 1423]}
slgidmnvkesvlcirltgeldhhtaetlkqkvtqslekddirhivlnledlsfmdssgl
gvilgrykqikqiggemvvcaispavkrlfdmsglfkiirfeqseqqalltlgvas

Timeline for d1auza_:

• d1auza_ first appeared (with stable ids) in SCOP 1.55, called d1auz__
  
• d1auza_ appears in SCOPe 2.07