Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d4qw4c_: 4qw4 C: [308691] Other proteins in same PDB: d4qw4a_, d4qw4b_, d4qw4e_, d4qw4f_, d4qw4g_, d4qw4h_, d4qw4i_, d4qw4j_, d4qw4k_, d4qw4l_, d4qw4m_, d4qw4n_, d4qw4o_, d4qw4p_, d4qw4s_, d4qw4t_, d4qw4u_, d4qw4v_, d4qw4w_, d4qw4x_, d4qw4y_, d4qw4z_ automated match to d4eu2a_ complexed with 3bv, cl, mes, mg |
PDB Entry: 4qw4 (more details), 2.8 Å
SCOPe Domain Sequences for d4qw4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qw4c_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qw4c_: