Lineage for d4qw3q1 (4qw3 Q:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996034Domain d4qw3q1: 4qw3 Q:1-234 [308680]
    Other proteins in same PDB: d4qw3a_, d4qw3b_, d4qw3c2, d4qw3d_, d4qw3e_, d4qw3f_, d4qw3g_, d4qw3h_, d4qw3i_, d4qw3j_, d4qw3k_, d4qw3l_, d4qw3m_, d4qw3n_, d4qw3o_, d4qw3p_, d4qw3q2, d4qw3r_, d4qw3s_, d4qw3t_, d4qw3u_, d4qw3v_, d4qw3w_, d4qw3x_, d4qw3y_, d4qw3z_
    automated match to d4eu2a_
    complexed with bo2, cl, mg; mutant

Details for d4qw3q1

PDB Entry: 4qw3 (more details), 2.9 Å

PDB Description: yCP beta5-C63F mutant in complex with bortezomib
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qw3q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw3q1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d4qw3q1:

Click to download the PDB-style file with coordinates for d4qw3q1.
(The format of our PDB-style files is described here.)

Timeline for d4qw3q1: