Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qw3q1: 4qw3 Q:1-234 [308680] Other proteins in same PDB: d4qw3a_, d4qw3b_, d4qw3c2, d4qw3d_, d4qw3e_, d4qw3f_, d4qw3g_, d4qw3h_, d4qw3i_, d4qw3j_, d4qw3k_, d4qw3l_, d4qw3m_, d4qw3n_, d4qw3o_, d4qw3p_, d4qw3q2, d4qw3r_, d4qw3s_, d4qw3t_, d4qw3u_, d4qw3v_, d4qw3w_, d4qw3x_, d4qw3y_, d4qw3z_ automated match to d4eu2a_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qw3 (more details), 2.9 Å
SCOPe Domain Sequences for d4qw3q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qw3q1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d4qw3q1:
View in 3D Domains from other chains: (mouse over for more information) d4qw3a_, d4qw3b_, d4qw3c1, d4qw3c2, d4qw3d_, d4qw3e_, d4qw3f_, d4qw3g_, d4qw3h_, d4qw3i_, d4qw3j_, d4qw3k_, d4qw3l_, d4qw3m_, d4qw3n_, d4qw3o_, d4qw3p_, d4qw3r_, d4qw3s_, d4qw3t_, d4qw3u_, d4qw3v_, d4qw3w_, d4qw3x_, d4qw3y_, d4qw3z_ |