![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N |
![]() | Superfamily c.10.2: L domain-like [52058] (7 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.1: Internalin LRR domain [52059] (3 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
![]() | Protein Internalin B [52060] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [52061] (3 PDB entries) |
![]() | Domain d1d0ba_: 1d0b A: [30866] |
PDB Entry: 1d0b (more details), 1.86 Å
SCOP Domain Sequences for d1d0ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0ba_ c.10.2.1 (A:) Internalin B {Listeria monocytogenes} etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl sknhisdlralaglknldvlelfsqec
Timeline for d1d0ba_: