Lineage for d1d0ba_ (1d0b A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240418Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 240457Superfamily c.10.2: L domain-like [52058] (7 families) (S)
    less regular structure consisting of variable repeats
  5. 240458Family c.10.2.1: Internalin LRR domain [52059] (3 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 240465Protein Internalin B [52060] (1 species)
  7. 240466Species Listeria monocytogenes [TaxId:1639] [52061] (3 PDB entries)
  8. 240468Domain d1d0ba_: 1d0b A: [30866]

Details for d1d0ba_

PDB Entry: 1d0b (more details), 1.86 Å

PDB Description: internalin b leucine rich repeat domain

SCOP Domain Sequences for d1d0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ba_ c.10.2.1 (A:) Internalin B {Listeria monocytogenes}
etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis
dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
sknhisdlralaglknldvlelfsqec

SCOP Domain Coordinates for d1d0ba_:

Click to download the PDB-style file with coordinates for d1d0ba_.
(The format of our PDB-style files is described here.)

Timeline for d1d0ba_: