Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N |
Superfamily c.10.1: RNI-like [52047] (3 families) regular structure consisting of similar repeats |
Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein) this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain |
Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species) GTPase-activating protein for SpI1, ortologue of Ran duplication: consists of 11 repeats |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (3 PDB entries) |
Domain d1yrgb_: 1yrg B: [30855] mutant |
PDB Entry: 1yrg (more details), 2.66 Å
SCOP Domain Sequences for d1yrgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yrgb_ c.10.1.2 (B:) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe)} arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme
Timeline for d1yrgb_: