Lineage for d1yrga_ (1yrg A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67777Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 67778Superfamily c.10.1: RNI-like [52047] (3 families) (S)
  5. 67787Family c.10.1.2: Rna1p [52052] (1 protein)
    this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain
  6. 67788Protein Rna1p [52053] (1 species)
  7. 67789Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (1 PDB entry)
  8. 67790Domain d1yrga_: 1yrg A: [30854]

Details for d1yrga_

PDB Entry: 1yrg (more details), 2.66 Å

PDB Description: the crystal structure of rna1p: a new fold for a gtpase-activating protein

SCOP Domain Sequences for d1yrga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrga_ c.10.1.2 (A:) Rna1p {Fission yeast (Schizosaccharomyces pombe)}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme

SCOP Domain Coordinates for d1yrga_:

Click to download the PDB-style file with coordinates for d1yrga_.
(The format of our PDB-style files is described here.)

Timeline for d1yrga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yrgb_