SCOP 1.57: Domain d1yrgb_: 1yrg B:

Lineage for d1yrgb_ (1yrg B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)

4. Superfamily c.10.1: RNI-like [52047] (3 families)

5. Family c.10.1.2: Rna1p [52052] (1 protein)
   this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain

6. Protein Rna1p [52053] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (1 PDB entry)

8. Domain d1yrgb_: 1yrg B: [30855]

Details for d1yrgb_

PDB Entry: 1yrg, 2.66 Å

PDB Description: the crystal structure of rna1p: a new fold for a gtpase-activating protein

SCOP Domain Sequences for d1yrgb_:

Sequence; same for both SEQRES and ATOM records:

>d1yrgb_ c.10.1.2 (B:) Rna1p {Fission yeast (Schizosaccharomyces pombe)}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme

Timeline for d1yrgb_:

• d1yrgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1yrgb_ appears in SCOP 1.59
  
• d1yrgb_ appears in the current release, SCOPe 2.08