Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qvpq_: 4qvp Q: [308512] Other proteins in same PDB: d4qvpa_, d4qvpb_, d4qvpd_, d4qvpe_, d4qvpf_, d4qvpg_, d4qvph_, d4qvpi_, d4qvpj_, d4qvpk_, d4qvpl_, d4qvpm_, d4qvpn_, d4qvpo_, d4qvpp_, d4qvpr_, d4qvps_, d4qvpt_, d4qvpu_, d4qvpv_, d4qvpw_, d4qvpx_, d4qvpy_, d4qvpz_ automated match to d4eu2a_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qvp (more details), 2.3 Å
SCOPe Domain Sequences for d4qvpq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qvpq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qvpq_: