Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (4 families) regular structure consisting of similar repeats |
Family c.10.1.1: 28-residue LRR [52048] (3 proteins) this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain |
Protein Ribonuclease inhibitor [52049] (2 species) duplication: consists of 16 repeats |
Species Pig (Sus scrofa) [TaxId:9823] [52050] (2 PDB entries) |
Domain d2bnha_: 2bnh A: [30850] |
PDB Entry: 2bnh (more details), 2.3 Å
SCOPe Domain Sequences for d2bnha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnha_ c.10.1.1 (A:) Ribonuclease inhibitor {Pig (Sus scrofa) [TaxId: 9823]} mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp gcaleqlvlydtywteevedrlqalegskpglrvis
Timeline for d2bnha_: