Lineage for d2bnha_ (2bnh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851637Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 2851638Family c.10.1.1: 28-residue LRR [52048] (3 proteins)
    this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain
  6. 2851639Protein Ribonuclease inhibitor [52049] (2 species)
    duplication: consists of 16 repeats
  7. 2851643Species Pig (Sus scrofa) [TaxId:9823] [52050] (2 PDB entries)
  8. 2851644Domain d2bnha_: 2bnh A: [30850]

Details for d2bnha_

PDB Entry: 2bnh (more details), 2.3 Å

PDB Description: porcine ribonuclease inhibitor
PDB Compounds: (A:) ribonuclease inhibitor

SCOPe Domain Sequences for d2bnha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnha_ c.10.1.1 (A:) Ribonuclease inhibitor {Pig (Sus scrofa) [TaxId: 9823]}
mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
gcaleqlvlydtywteevedrlqalegskpglrvis

SCOPe Domain Coordinates for d2bnha_:

Click to download the PDB-style file with coordinates for d2bnha_.
(The format of our PDB-style files is described here.)

Timeline for d2bnha_: