PDB entry 2bnh

View 2bnh on RCSB PDB site
Description: porcine ribonuclease inhibitor
Class: acetylation
Keywords: acetylation, leucine-rich repeats
Deposited on 1996-06-29, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease inhibitor
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bnha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bnhA (A:)
    mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
    nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
    gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
    garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
    elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
    esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
    sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
    gcaleqlvlydtywteevedrlqalegskpglrvis