![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
![]() | Superfamily c.9.1: Barstar-related [52038] (1 family) ![]() |
![]() | Family c.9.1.1: Barstar-related [52039] (3 proteins) |
![]() | Protein Barstar (barnase inhibitor) [52040] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries) |
![]() | Domain d1b27e_: 1b27 E: [30841] Other proteins in same PDB: d1b27a_, d1b27b_, d1b27c_ protein/RNA complex; mutant |
PDB Entry: 1b27 (more details), 2.1 Å
SCOPe Domain Sequences for d1b27e_:
Sequence, based on SEQRES records: (download)
>d1b27e_ c.9.1.1 (E:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]} kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk qltengaesvlqvfreakaegaditiils
>d1b27e_ c.9.1.1 (E:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]} kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfgaes vlqvfreakaegaditiils
Timeline for d1b27e_: