Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qv1q1: 4qv1 Q:1-234 [308248] Other proteins in same PDB: d4qv1a_, d4qv1b_, d4qv1c2, d4qv1d_, d4qv1e_, d4qv1f_, d4qv1g_, d4qv1h_, d4qv1i_, d4qv1j_, d4qv1k_, d4qv1l_, d4qv1m_, d4qv1n_, d4qv1o_, d4qv1p_, d4qv1q2, d4qv1r_, d4qv1s_, d4qv1t_, d4qv1u_, d4qv1v_, d4qv1w_, d4qv1x_, d4qv1y_, d4qv1z_ automated match to d4eu2a_ complexed with cl, mg; mutant |
PDB Entry: 4qv1 (more details), 2.5 Å
SCOPe Domain Sequences for d4qv1q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv1q1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d4qv1q1:
View in 3D Domains from other chains: (mouse over for more information) d4qv1a_, d4qv1b_, d4qv1c1, d4qv1c2, d4qv1d_, d4qv1e_, d4qv1f_, d4qv1g_, d4qv1h_, d4qv1i_, d4qv1j_, d4qv1k_, d4qv1l_, d4qv1m_, d4qv1n_, d4qv1o_, d4qv1p_, d4qv1r_, d4qv1s_, d4qv1t_, d4qv1u_, d4qv1v_, d4qv1w_, d4qv1x_, d4qv1y_, d4qv1z_ |