Lineage for d4omzc_ (4omz C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984544Species Sinorhizobium fredii [TaxId:380] [311408] (2 PDB entries)
  8. 1984551Domain d4omzc_: 4omz C: [307919]
    automated match to d3jthb_
    complexed with po4

Details for d4omzc_

PDB Entry: 4omz (more details), 2.64 Å

PDB Description: Crystal Structure of NolR from Sinorhizobium fredii
PDB Compounds: (C:) NolR

SCOPe Domain Sequences for d4omzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omzc_ a.4.5.0 (C:) automated matches {Sinorhizobium fredii [TaxId: 380]}
mqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhls
klraqnlvstrrdaqtiyyssssdsvmkilgalseiygaa

SCOPe Domain Coordinates for d4omzc_:

Click to download the PDB-style file with coordinates for d4omzc_.
(The format of our PDB-style files is described here.)

Timeline for d4omzc_: