SCOPe 2.06: Domain d4ogga1: 4ogg A:3-190

Lineage for d4ogga1 (4ogg A:3-190)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (20 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267895] (3 PDB entries)

8. Domain d4ogga1: 4ogg A:3-190 [307885]
   Other proteins in same PDB: d4oggb3, d4oggc3
   automated match to d3uk7a1

Details for d4ogga1

PDB Entry: 4ogg, 1.6 Å

PDB Description: Crystal Structure of Arabidopsis thaliana DJ-1d with glyoxylate as substrate analog

PDB Compounds: (A:) Protein DJ-1 homolog D

SCOPe Domain Sequences for d4ogga1:

Sequence; same for both SEQRES and ATOM records:

>d4ogga1 c.23.16.0 (A:3-190) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nsrtvlilcgdymedyevmvpfqalqafgitvhtvcpgkkagdscptavhdfcghqtyfe
srghnftlnatfdevdlskydglvipggrapeylaltasvvelvkefsrsgkpiasixhg
qlilaaadtvngrkctayatvgpslvaagakwvepitpdvcvvdgslitaatyeghpefi
qlfvkalg

Timeline for d4ogga1:

• d4ogga1 is new in SCOPe 2.06-stable
  
• d4ogga1 appears in SCOPe 2.07
  
• d4ogga1 appears in the current release, SCOPe 2.08