Lineage for d4ofwf2 (4ofw F:191-388)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467511Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2467512Protein automated matches [190197] (24 species)
    not a true protein
  7. 2467741Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267895] (3 PDB entries)
  8. 2467765Domain d4ofwf2: 4ofw F:191-388 [307874]
    Other proteins in same PDB: d4ofwa3, d4ofwb3, d4ofwc3, d4ofwd3, d4ofwe3, d4ofwf3
    automated match to d3uk7a2

Details for d4ofwf2

PDB Entry: 4ofw (more details), 2.3 Å

PDB Description: crystal structure of arabidopsis thaliana dj-1d
PDB Compounds: (F:) Protein DJ-1 homolog D

SCOPe Domain Sequences for d4ofwf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ofwf2 c.23.16.0 (F:191-388) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gkitgankrilflcgdymedyevkvpfqslqalgcqvdavcpekkagercptaihdfegd
qtysekpghtfalttnfddlvsssydalvipggrapeylalnehvlnivkefmnsekpva
sichgqqilaaagvlkgrkctaypavklnvvlgggtwlepdpidrcftdgnlvtgaawpg
hpefvsqlmallgiqvsf

SCOPe Domain Coordinates for d4ofwf2:

Click to download the PDB-style file with coordinates for d4ofwf2.
(The format of our PDB-style files is described here.)

Timeline for d4ofwf2: