SCOP 1.61: Domain d1oele2: 1oel E:191-366

Lineage for d1oele2 (1oel E:191-366)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families)

5. Family c.8.5.1: GroEL [52030] (1 protein)

6. Protein GroEL [52031] (3 species)

7. Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)

8. Domain d1oele2: 1oel E:191-366 [30785]
   Other proteins in same PDB: d1oela1, d1oela3, d1oelb1, d1oelb3, d1oelc4, d1oelc5, d1oeld1, d1oeld3, d1oele1, d1oele3, d1oelf1, d1oelf3, d1oelg1, d1oelg3

Details for d1oele2

PDB Entry: 1oel, 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution

SCOP Domain Sequences for d1oele2:

Sequence; same for both SEQRES and ATOM records:

>d1oele2 c.8.5.1 (E:191-366) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatavvntirgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

Timeline for d1oele2:

• d1oele2 first appeared (with stable ids) in SCOP 1.55
  
• d1oele2 appears in SCOP 1.59
  
• d1oele2 appears in SCOP 1.63
  
• d1oele2 appears in the current release, SCOPe 2.08