SCOPe 2.06: Domain d4nz8a4: 4nz8 A:634-963

Lineage for d4nz8a4 (4nz8 A:634-963)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (14 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311380] (11 PDB entries)

8. Domain d4nz8a4: 4nz8 A:634-963 [307799]
   Other proteins in same PDB: d4nz8a1, d4nz8a2, d4nz8a3, d4nz8a5
   automated match to d4fyta4
   complexed with nag, so4, zn

Details for d4nz8a4

PDB Entry: 4nz8, 2 Å

PDB Description: crystal structure of porcine aminopeptidase-n complexed with cleaved poly-alanine

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4nz8a4:

Sequence; same for both SEQRES and ATOM records:

>d4nz8a4 a.118.1.0 (A:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq
aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina
istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql
qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla
wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra
leqalektkanikwvkenkevvlnwfiehs

Timeline for d4nz8a4:

• d4nz8a4 is new in SCOPe 2.06-stable
  
• d4nz8a4 appears in SCOPe 2.07
  
• d4nz8a4 appears in the current release, SCOPe 2.08