Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 |
Protein automated matches [190609] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187631] (7 PDB entries) |
Domain d4kt1e_: 4kt1 E: [307653] automated match to d4bspa_ complexed with nag |
PDB Entry: 4kt1 (more details), 2.5 Å
SCOPe Domain Sequences for d4kt1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kt1e_ g.3.9.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} acakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikck iehceacfshnfctkckeglylhkgrcypa
Timeline for d4kt1e_: