Class a: All alpha proteins [46456] (289 folds) |
Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily) |
Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) Pfam PF05733 |
Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins) |
Protein automated matches [310887] (1 species) not a true protein |
Species Granada virus [TaxId:904668] [311388] (2 PDB entries) |
Domain d4j4yb_: 4j4y B: [307575] automated match to d4h5la_ mutant |
PDB Entry: 4j4y (more details), 2.45 Å
SCOPe Domain Sequences for d4j4yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j4yb_ a.299.1.1 (B:) automated matches {Granada virus [TaxId: 904668]} ednyrtialafldesadsttinawvnefayqgfdpkrivqlvkergtakgrdwkkdvkmm ivlnlvdgnepesmmkemsekgaaivtqlistyqlkegnpgrdtitlsrvsaafvpwtvq alktlseslpvtgttmdsiagttyprcmmhpsfagiidlelpnntgamladahglfmlef sktinpslrtkqpneiaatfekpnmaamtgrfftrddkkklliaigvlnedlvpnpaiek caekykak
Timeline for d4j4yb_: