Lineage for d4j4ya_ (4j4y A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2352342Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)
  4. 2352343Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) (S)
    Pfam PF05733
  5. 2352344Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins)
  6. 2352380Protein automated matches [310887] (1 species)
    not a true protein
  7. 2352381Species Granada virus [TaxId:904668] [311388] (2 PDB entries)
  8. 2352388Domain d4j4ya_: 4j4y A: [307574]
    automated match to d4h5la_
    mutant

Details for d4j4ya_

PDB Entry: 4j4y (more details), 2.45 Å

PDB Description: Triple mutant GraVN
PDB Compounds: (A:) NP protein

SCOPe Domain Sequences for d4j4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4ya_ a.299.1.1 (A:) automated matches {Granada virus [TaxId: 904668]}
dnyrtialafldesadsttinawvnefayqgfdpkrivqlvkergtakgrdwkkdvkmmi
vlnlvdgnepesmmkemsekgaaivtqlistyqlkegnpgrdtitlsrvsaafvpwtvqa
lktlseslpvtgttmdsiagttyprcmmhpsfagiidlelpnntgamladahglfmlefs
ktinpslrtkqpneiaatfekpnmaamtgrfftrddkkklliaigvlnedlvpnpaiekc
aekykakvgk

SCOPe Domain Coordinates for d4j4ya_:

Click to download the PDB-style file with coordinates for d4j4ya_.
(The format of our PDB-style files is described here.)

Timeline for d4j4ya_: