Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (41 species) not a true protein |
Species Yersinia pestis [TaxId:187410] [226504] (3 PDB entries) |
Domain d4gwhf3: 4gwh F:2-115 [307476] automated match to d4qfwd2 |
PDB Entry: 4gwh (more details), 2 Å
SCOPe Domain Sequences for d4gwhf3:
Sequence, based on SEQRES records: (download)
>d4gwhf3 d.38.1.0 (F:2-115) automated matches {Yersinia pestis [TaxId: 187410]} sqaleklldlldlekieegifrgqsedlglrqvfggqvvgqaiyaakqtvpaertvhsfh syflrpgdsskpiiydvetlrdgnsfsarrvsaiqngkpifymtasfqsqeegf
>d4gwhf3 d.38.1.0 (F:2-115) automated matches {Yersinia pestis [TaxId: 187410]} sqaleklldlldlekieegifrgqseqvfggqvvgqaiyaakqtvpaertvhsfhsyflr pgdsskpiiydvetlrdgnsfsarrvsaiqngkpifymtasfqsqeegf
Timeline for d4gwhf3: