Lineage for d4gpqa1 (4gpq A:2-230)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012103Fold d.389: Menin N-terminal domain-like [310556] (1 superfamily)
    Some structural similarity to cysteine proteinases (d.3.1.4) noted in PubMed 22327296
  4. 3012104Superfamily d.389.1: Menin N-terminal domain-like [310582] (1 family) (S)
    Pfam PF05053
  5. 3012105Family d.389.1.1: Menin N-terminal domain-like [310623] (2 proteins)
  6. 3012106Protein Menin N-terminal domain [310724] (2 species)
  7. 3012107Species Human (Homo sapiens) [TaxId:9606] [310972] (34 PDB entries)
  8. 3012109Domain d4gpqa1: 4gpq A:2-230 [307460]
    Other proteins in same PDB: d4gpqa2
    automated match to d3u85a1
    complexed with epe, peg, pg4

Details for d4gpqa1

PDB Entry: 4gpq (more details), 1.46 Å

PDB Description: Structural insights into inhibition of the bivalent menin-MLL interaction by small molecules in leukemia
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d4gpqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpqa1 d.389.1.1 (A:2-230) Menin N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgltyfpva
dlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfkdrahiq
slfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtaevtwhgk
gnedrrgqtvnagvaerswlylkgsymrc

SCOPe Domain Coordinates for d4gpqa1:

Click to download the PDB-style file with coordinates for d4gpqa1.
(The format of our PDB-style files is described here.)

Timeline for d4gpqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gpqa2