Lineage for d1a9xd1 (1a9x D:3502-3652)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979734Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 979813Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 979814Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 979815Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 979816Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
    Uniprot P00907
  8. 979818Domain d1a9xd1: 1a9x D:3502-3652 [30733]
    Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh2
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1a9xd1

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis
PDB Compounds: (D:) carbamoyl phosphate synthetase (small chain)

SCOPe Domain Sequences for d1a9xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xd1 c.8.3.1 (D:3502-3652) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOPe Domain Coordinates for d1a9xd1:

Click to download the PDB-style file with coordinates for d1a9xd1.
(The format of our PDB-style files is described here.)

Timeline for d1a9xd1: