Lineage for d4d7ra2 (4d7r A:196-352)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2976266Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family) (S)
    contains a single copy of this fold decorated with additional structures
  5. 2976267Family d.129.9.1: RalF, C-terminal domain [118105] (2 proteins)
  6. 2976272Protein automated matches [254743] (2 species)
    not a true protein
  7. 2976275Species Rickettsia prowazekii [TaxId:272947] [311370] (1 PDB entry)
  8. 2976276Domain d4d7ra2: 4d7r A:196-352 [307240]
    Other proteins in same PDB: d4d7ra1, d4d7ra3
    automated match to d1xsza2

Details for d4d7ra2

PDB Entry: 4d7r (more details), 1.8 Å

PDB Description: crystal structure of a chimeric protein with the sec7 domain of rickettsia prowazekii ralf and the capping domain of legionella pneumophila ralf
PDB Compounds: (A:) proline/betaine transporter, ralf

SCOPe Domain Sequences for d4d7ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d7ra2 d.129.9.1 (A:196-352) automated matches {Rickettsia prowazekii [TaxId: 272947]}
ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfftg
ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss
pvknfkatydyevgdlikaydnqkklitiernlalke

SCOPe Domain Coordinates for d4d7ra2:

Click to download the PDB-style file with coordinates for d4d7ra2.
(The format of our PDB-style files is described here.)

Timeline for d4d7ra2: