![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family) ![]() contains a single copy of this fold decorated with additional structures |
![]() | Family d.129.9.1: RalF, C-terminal domain [118105] (2 proteins) |
![]() | Protein automated matches [254743] (2 species) not a true protein |
![]() | Species Rickettsia prowazekii [TaxId:272947] [311370] (1 PDB entry) |
![]() | Domain d4d7ra2: 4d7r A:196-352 [307240] Other proteins in same PDB: d4d7ra1, d4d7ra3 automated match to d1xsza2 |
PDB Entry: 4d7r (more details), 1.8 Å
SCOPe Domain Sequences for d4d7ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d7ra2 d.129.9.1 (A:196-352) automated matches {Rickettsia prowazekii [TaxId: 272947]} ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfftg ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss pvknfkatydyevgdlikaydnqkklitiernlalke
Timeline for d4d7ra2: