Lineage for d4d7ra1 (4d7r A:2-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726245Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2726283Family a.118.3.0: automated matches [191673] (1 protein)
    not a true family
  6. 2726284Protein automated matches [191283] (3 species)
    not a true protein
  7. 2726298Species Rickettsia prowazekii [TaxId:272947] [311369] (1 PDB entry)
  8. 2726299Domain d4d7ra1: 4d7r A:2-195 [307239]
    Other proteins in same PDB: d4d7ra2, d4d7ra3
    automated match to d1xsza1

Details for d4d7ra1

PDB Entry: 4d7r (more details), 1.8 Å

PDB Description: crystal structure of a chimeric protein with the sec7 domain of rickettsia prowazekii ralf and the capping domain of legionella pneumophila ralf
PDB Compounds: (A:) proline/betaine transporter, ralf

SCOPe Domain Sequences for d4d7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d7ra1 a.118.3.0 (A:2-195) automated matches {Rickettsia prowazekii [TaxId: 272947]}
dsllkneviklfndkpksgiarikkwctdnnqdfiaetakifyeeksnlnlefvgdylgt
dgvdnqkvlesftkqfdfkekdyleslrrflqsfklpgeaqkidrlvesfgthyyeqnln
idinskdaayilayqtimlntdlhnpsiakskkmtfeqlknnlkgtnesknfndnflkki
ydeieakpfklnfv

SCOPe Domain Coordinates for d4d7ra1:

Click to download the PDB-style file with coordinates for d4d7ra1.
(The format of our PDB-style files is described here.)

Timeline for d4d7ra1: