![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
![]() | Family a.118.3.0: automated matches [191673] (1 protein) not a true family |
![]() | Protein automated matches [191283] (3 species) not a true protein |
![]() | Species Rickettsia prowazekii [TaxId:272947] [311369] (1 PDB entry) |
![]() | Domain d4d7ra1: 4d7r A:2-195 [307239] Other proteins in same PDB: d4d7ra2, d4d7ra3 automated match to d1xsza1 |
PDB Entry: 4d7r (more details), 1.8 Å
SCOPe Domain Sequences for d4d7ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d7ra1 a.118.3.0 (A:2-195) automated matches {Rickettsia prowazekii [TaxId: 272947]} dsllkneviklfndkpksgiarikkwctdnnqdfiaetakifyeeksnlnlefvgdylgt dgvdnqkvlesftkqfdfkekdyleslrrflqsfklpgeaqkidrlvesfgthyyeqnln idinskdaayilayqtimlntdlhnpsiakskkmtfeqlknnlkgtnesknfndnflkki ydeieakpfklnfv
Timeline for d4d7ra1: