SCOPe 2.06: Domain d6acna1: 6acn A:529-754

Lineage for d6acna1 (6acn A:529-754)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.1: LeuD-like [52017] (4 proteins)
   Pfam PF00694; permutation of the domain order in the proteins containing this family domain

6. Protein Aconitase A, C-terminal domain [52018] (2 species)
   other three domains have alpha/beta folds

7. Species Pig (Sus scrofa) [TaxId:9823] [52019] (6 PDB entries)

8. Domain d6acna1: 6acn A:529-754 [30721]
   Other proteins in same PDB: d6acna2
   complexed with sf4, so4, trc

Details for d6acna1

PDB Entry: 6acn, 2.5 Å

PDB Description: structure of activated aconitase. formation of the (4fe-4s) cluster in the crystal

PDB Compounds: (A:) aconitase

SCOPe Domain Sequences for d6acna1:

Sequence; same for both SEQRES and ATOM records:

>d6acna1 c.8.2.1 (A:529-754) Aconitase A, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsa
leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk

Timeline for d6acna1:

• d6acna1 first appeared (with stable ids) in SCOP 1.55, called d6acn_1
  
• d6acna1 appears in SCOPe 2.05
  
• d6acna1 appears in SCOPe 2.07
  
• d6acna1 appears in the current release, SCOPe 2.08