Lineage for d4crda_ (4crd A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2064823Protein Coagulation factor XI [117237] (1 species)
  7. 2064824Species Human (Homo sapiens) [TaxId:9606] [117238] (45 PDB entries)
    Uniprot P03951 388-624
  8. 2064852Domain d4crda_: 4crd A: [307156]
    automated match to d1zhra_
    complexed with otj, so4

Details for d4crda_

PDB Entry: 4crd (more details), 2.1 Å

PDB Description: Creating novel F1 inhibitors through fragment based lead generation and structure aided drug design
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d4crda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4crda_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq

SCOPe Domain Coordinates for d4crda_:

Click to download the PDB-style file with coordinates for d4crda_.
(The format of our PDB-style files is described here.)

Timeline for d4crda_: