Lineage for d4cdkf_ (4cdk F:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635726Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2635727Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
  6. 2635775Protein Stem cell growth factor R-spondin-1 (Rspo1) Furin (Fu1Fu2) domain [310761] (1 species)
  7. 2635776Species Human (Homo sapiens) [TaxId:9606] [311016] (2 PDB entries)
  8. 2635779Domain d4cdkf_: 4cdk F: [307108]
    automated match to d4bspa_

Details for d4cdkf_

PDB Entry: 4cdk (more details), 2.8 Å

PDB Description: structure of znrf3-rspo1
PDB Compounds: (F:) r-spondin-1

SCOPe Domain Sequences for d4cdkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cdkf_ g.3.9.1 (F:) Stem cell growth factor R-spondin-1 (Rspo1) Furin (Fu1Fu2) domain {Human (Homo sapiens) [TaxId: 9606]}
cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki
ehceacfshnfctkckeglylhkgrcypacpegssaangtmec

SCOPe Domain Coordinates for d4cdkf_:

Click to download the PDB-style file with coordinates for d4cdkf_.
(The format of our PDB-style files is described here.)

Timeline for d4cdkf_: