Lineage for d3uykb_ (3uyk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142583Species Saccharopolyspora spinosa [TaxId:60894] [311342] (3 PDB entries)
  8. 2142587Domain d3uykb_: 3uyk B: [306670]
    Other proteins in same PDB: d3uyka2
    automated match to d2p6pa_
    complexed with 0cx, bgc, mg

Details for d3uykb_

PDB Entry: 3uyk (more details), 1.7 Å

PDB Description: Spinosyn Rhamnosyltransferase SpnG complexed with spinosyn aglycone
PDB Compounds: (B:) NDP-rhamnosyltransferase

SCOPe Domain Sequences for d3uykb_:

Sequence, based on SEQRES records: (download)

>d3uykb_ c.87.1.0 (B:) automated matches {Saccharopolyspora spinosa [TaxId: 60894]}
mrvlvvplpypthlmamvplcwalqasghevliaappelqatahgaglttagirgndrtg
dtggttqlrfpnpafgqrdteagrqlweqtasnvaqssldqlpeylrlaeawrpsvllvd
vcaligrvlgglldlpvvlhrwgvdptagpfsdrahelldpvcrhhgltglptpelildp
cppslqasdapqgapvqyvpyngsgafpawgaartsarrvcicmgrmvlnatgpapllra
vaaatelpgveaviavppehralltdlpdnariaesvplnlflrtcelvicaggsgtaft
atrlgipqlvlpqyfdqfdyarnlaaagagiclpdeqaqsdheqftdsiatvlgdtgfaa
aaiklsdeitamphpaalvrtlen

Sequence, based on observed residues (ATOM records): (download)

>d3uykb_ c.87.1.0 (B:) automated matches {Saccharopolyspora spinosa [TaxId: 60894]}
mrvlvvplpypthlmamvplcwalqasghevliaappelqatahgaglttagirfpnpaf
gqrdteagrqlweqtasnvaqssldqlpeylrlaeawrpsvllvdvcaligrvlgglldl
pvvlhrwgvdptagpfsdrahelldpvcrhhgltglptpelildpcppslqasdapqgap
vqyvpyngsgafpawgaartsarrvcicmgrmvlnatgpapllravaaatelpgveavia
vppehralltdlpdnariaesvplnlflrtcelvicaggsgtaftatrlgipqlvlpqyf
dqfdyarnlaaagagiclpdeqaqsdheqftdsiatvlgdtgfaaaaiklsdeitamphp
aalvrtlen

SCOPe Domain Coordinates for d3uykb_:

Click to download the PDB-style file with coordinates for d3uykb_.
(The format of our PDB-style files is described here.)

Timeline for d3uykb_:

  • d3uykb_ is new in SCOPe 2.06-stable