![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:316057] [267894] (8 PDB entries) |
![]() | Domain d3ukja_: 3ukj A: [306661] automated match to d3uk0a_ complexed with eno, gol, pr |
PDB Entry: 3ukj (more details), 1.6 Å
SCOPe Domain Sequences for d3ukja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ukja_ c.93.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316057]} neitvgitvtttgpaaalgipernalefvakeigghpikmivlddggdptaattnarrfv teskadvimgssvtpptvavsnvaneaqvphialaplpvtperakwsvvmpqpipimgkv lyehmkknniktvgyigysdsygdlwfndlkkqgeamglkivaeerfarpdtsvagqvlk lvaanpdailvgasgtaaalpqtalrergyngliyqthgaasmdfiriagksaegvlmas gpvmdpegqndsaltkkpglelntayetkygpnsrsqfaghsfdafkvlervipvalkta kpgtqefreairkalltekdiaasqgvysftetdryglddrsrilltvkngkyvivk
Timeline for d3ukja_: