Lineage for d3ukja_ (3ukj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913528Species Rhodopseudomonas palustris [TaxId:316057] [267894] (8 PDB entries)
  8. 2913530Domain d3ukja_: 3ukj A: [306661]
    automated match to d3uk0a_
    complexed with eno, gol, pr

Details for d3ukja_

PDB Entry: 3ukj (more details), 1.6 Å

PDB Description: Crystal structure of extracellular ligand-binding receptor from Rhodopseudomonas palustris HaA2
PDB Compounds: (A:) Extracellular ligand-binding receptor

SCOPe Domain Sequences for d3ukja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukja_ c.93.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316057]}
neitvgitvtttgpaaalgipernalefvakeigghpikmivlddggdptaattnarrfv
teskadvimgssvtpptvavsnvaneaqvphialaplpvtperakwsvvmpqpipimgkv
lyehmkknniktvgyigysdsygdlwfndlkkqgeamglkivaeerfarpdtsvagqvlk
lvaanpdailvgasgtaaalpqtalrergyngliyqthgaasmdfiriagksaegvlmas
gpvmdpegqndsaltkkpglelntayetkygpnsrsqfaghsfdafkvlervipvalkta
kpgtqefreairkalltekdiaasqgvysftetdryglddrsrilltvkngkyvivk

SCOPe Domain Coordinates for d3ukja_:

Click to download the PDB-style file with coordinates for d3ukja_.
(The format of our PDB-style files is described here.)

Timeline for d3ukja_: