![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (25 species) not a true protein |
![]() | Species Leishmania major [TaxId:5664] [267828] (3 PDB entries) |
![]() | Domain d3uiba_: 3uib A: [306660] automated match to d3pg1a_ complexed with sb2 |
PDB Entry: 3uib (more details), 2.65 Å
SCOPe Domain Sequences for d3uiba_:
Sequence, based on SEQRES records: (download)
>d3uiba_ d.144.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]} aamrdliaelhamqspytvqrfissgsygavcagvdsegipvaikrvfntvsdgrtvnil sdsflckrvlreirllnhfhhpnilglrdifvhfeepamhklylvtelmrtdlaqvihdq rivispqhiqyfmyhillglhvlheagvvhrdlhpgnilladnnditicdfnlaredtad ankthyvthrwyrapelvmqfkgftklvdmwsagcvmaemfnrkalfrgstfynqlnkiv evvgtpkiedvvmfsspsardylrnslsnvparawtavvptadpvaldliakmlefnpqr risteqalrhpyfeslfdpldlteglserfhfdesvtdvydmhkiftaeverf
>d3uiba_ d.144.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]} aamrdliaelvqrygavcagvdsegipvaikrvfntnilsdsflckrvlreirllnhfhh pnilglrdilylvtelmrtdlaqvihdqrivispqhiqyfmyhillglhvlheagvvhrd lhpgnilladnnditicdfnlyvthrwyrapelvmqfkgftklvdmwsagcvmaemfnrk alfrgstfynqlnkivevvgtpkiedvvmfsspsardylrnslsnvparawtavvptadp valdliakmlefnpqrristeqalrhpyfeslfdpldlteglserfhfdesvtdvydmhk iftaeverf
Timeline for d3uiba_: