SCOPe 2.03: Domain d1e0da1: 1e0d A:1-93

Lineage for d1e0da1 (1e0d A:1-93)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family)

5. Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)

6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)

7. Species Escherichia coli [TaxId:562] [51987] (11 PDB entries)

8. Domain d1e0da1: 1e0d A:1-93 [30655]
   Other proteins in same PDB: d1e0da2, d1e0da3
   complexed with so4

Details for d1e0da1

PDB Entry: 1e0d, 2.4 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d1e0da1:

Sequence; same for both SEQRES and ATOM records:

>d1e0da1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

Timeline for d1e0da1:

• d1e0da1 first appeared (with stable ids) in SCOP 1.55
  
• d1e0da1 appears in SCOPe 2.02
  
• d1e0da1 appears in SCOPe 2.04
  
• d1e0da1 appears in the current release, SCOPe 2.08