Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [310976] (3 PDB entries) |
Domain d3tiga1: 3tig A:2-76 [306548] Other proteins in same PDB: d3tiga2, d3tiga3 automated match to d3tiia1 complexed with mg |
PDB Entry: 3tig (more details), 2.5 Å
SCOPe Domain Sequences for d3tiga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tiga1 c.30.1.9 (A:2-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} ytfvvrdenstvyaevakillasgqwkrlkrdnpkfnlmlgernrlpfgrlghepglvql vnyyrgadklcrkas
Timeline for d3tiga1: