Lineage for d1uaga1 (1uag A:1-93)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155143Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 1155144Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) (S)
  5. 1155145Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 1155158Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. 1155159Species Escherichia coli [TaxId:562] [51987] (11 PDB entries)
  8. 1155166Domain d1uaga1: 1uag A:1-93 [30653]
    Other proteins in same PDB: d1uaga2, d1uaga3
    complexed with so4, uma

Details for d1uaga1

PDB Entry: 1uag (more details), 1.95 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoyl-l-alanine/:d-glutamate ligase

SCOPe Domain Sequences for d1uaga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uaga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d1uaga1:

Click to download the PDB-style file with coordinates for d1uaga1.
(The format of our PDB-style files is described here.)

Timeline for d1uaga1: