SCOPe 2.01: Domain d4uaga1: 4uag A:1-93

Lineage for d4uaga1 (4uag A:1-93)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family)

5. Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)

6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)

7. Species Escherichia coli [TaxId:562] [51987] (11 PDB entries)

8. Domain d4uaga1: 4uag A:1-93 [30651]
   Other proteins in same PDB: d4uaga2, d4uaga3
   complexed with so4, uag, unx

Details for d4uaga1

PDB Entry: 4uag, 1.66 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

PDB Compounds: (A:) udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOPe Domain Sequences for d4uaga1:

Sequence; same for both SEQRES and ATOM records:

>d4uaga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

Timeline for d4uaga1:

• d4uaga1 first appeared (with stable ids) in SCOP 1.55
  
• d4uaga1 appears in SCOP 1.75
  
• d4uaga1 appears in SCOPe 2.02
  
• d4uaga1 appears in the current release, SCOPe 2.08