SCOPe 2.08: Domain d3qkfc2: 3qkf C:114-405

Lineage for d3qkfc2 (3qkf C:114-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:158080] [267865] (6 PDB entries)

8. Domain d3qkfc2: 3qkf C:114-405 [306368]
   Other proteins in same PDB: d3qkfa1, d3qkfa3, d3qkfb1, d3qkfb3, d3qkfc1, d3qkfc3, d3qkfd1, d3qkfd3, d3qkfe1, d3qkfe3, d3qkff1, d3qkff3, d3qkfg1, d3qkfg3, d3qkfh1, d3qkfh3
   automated match to d3thua2
   complexed with gco, mg; mutant

Details for d3qkfc2

PDB Entry: 3qkf, 1.45 Å

PDB Description: Crystal structure of the mutant P317A of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with Mg and D-Gluconate

PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3qkfc2:

Sequence, based on SEQRES records:

>d3qkfc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep
adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy
hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg
gitamrrvadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdav
fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw

Sequence, based on observed residues (ATOM records):

>d3qkfc2 c.1.11.0 (C:114-405) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvasslpaehvw
stekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpa
enqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadl
aslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedgh
flagespghgvdideelaakypyeraslpvnrledgtlwhw

Timeline for d3qkfc2:

• d3qkfc2 first appeared in SCOPe 2.06
  
• d3qkfc2 appears in SCOPe 2.07