![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (79 species) not a true protein |
![]() | Species Sphingomonas sp. [TaxId:314266] [267886] (1 PDB entry) |
![]() | Domain d3thua2: 3thu A:113-403 [265381] Other proteins in same PDB: d3thua1, d3thua3, d3thub1, d3thub3, d3thuc1, d3thuc3 automated match to d4il2a2 complexed with cl, gol, mg, unx |
PDB Entry: 3thu (more details), 1.8 Å
SCOPe Domain Sequences for d3thua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3thua2 c.1.11.0 (A:113-403) automated matches {Sphingomonas sp. [TaxId: 314266]} asregvmvyghangttiedtvkvaldyqaqgykairlqcgvpgmastygvskdkyfyepa dadlpteniwntskylrivpelfkaareslgwdvhllhdihhrltpieagrlgqdlepyr pfwledatpaenqeafrlirqhttaplavgeifnsiwdakdliqnqlidyiratvvhagg ithlrriaaladlyqirtgchgatdlspvcmaaalhfdlsvpnfgiqeymrhmpetdavf phaytfadgmmhpgdqpglgvdidedlaagyeykraflpvnrledgtmfnw
Timeline for d3thua2: